epithalone Epithalon (also spelled Epitalon or Epithalone) is a synthetic tetrapeptide developed from research into pineal gland extracts, particularly a bovine pineal extract called epithalamin. It was largely Overview of Epitalon—Highly Bioactive Pineal

3.GHK Cu: Improving microcirculation of hair follicles Hair follicles have a very high metabolic activity efficiency

Historically, clinical endpoints such as response rates, progression-free survival, and overall survival have dominated clinical research

Traditional Pain Management Unlike opioid medications, which only mask pain and carry significant risks of dependency and side effects, peptides address the underlying pathology

Cagrilintide 5mg Strength: 5 mg CAS: 1415456-99-3 Chemical Formula: CHNOS Molecular weight: 4409 g/mol Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Synonyms: NN0174-0833, AM833, EX-A10092 Storage: Store 28 C (20 C long-term)